PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g005370.1.1
Common NameLOC104647249
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 225aa    MW: 24791.2 Da    PI: 4.3296
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g005370.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB95.74e-3054134284
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 
                         +eqd+++P  nv+rim+ + P++ kis+dak t+ +c+sefi fvt ea+ +cqre+r+ti+ +d+ w + ++Gf+dy+epl 
  Solyc05g005370.1.1  54 QEQDQVIP--NVARIMQSTHPSHVKISDDAKRTIYHCMSEFICFVTYEANAHCQREQRNTITVEDMDWVINKFGFDDYIEPLP 134
                         57788776..***********************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-2554133IPR009072Histone-fold
SuperFamilySSF471136.87E-2261136IPR009072Histone-fold
PfamPF008082.1E-1762121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDNGNHLGGS GNGGFHSYGR SPQPTPADPP SPDTEMSLEL PAHLNQEVVE IISQEQDQVI  60
PNVARIMQST HPSHVKISDD AKRTIYHCMS EFICFVTYEA NAHCQREQRN TITVEDMDWV  120
INKFGFDDYI EPLPYNFPPN SEDDGGECGS LTRESLLKRP MVDTASSSNI TSYNVPSNFP  180
MAHHHFVYPP PMGNGDMQGR ASTSQCAGAS VDTDVESPME EDKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-1954134385NF-YB
4awl_B5e-1954134486NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-1954134486NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2040820.0Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320572.11e-169PREDICTED: nuclear transcription factor Y subunit B-6-like
TrEMBLK4BW681e-169K4BW68_SOLLC; Uncharacterized protein
STRINGSolyc05g005370.1.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14016414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-32NF-YB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]